Heavy Equipment Field Technician Jobs in Wichita, KS

Job Description:As a Remote Disney Vacation Specialist you will be an essential part of our team guiding clients through every stage of their journey from the moment they plan their trip to their safe return home. Your role is to ensure a seamless stress-free experience by assisting with travel arra...

Overview:Performs work as part of a team in an industrial laundry facility. Responsible for the safe expeditious and accurate handling of merchandise into and/or out of the laundry facility. Responsibilities/Essential Functions:Prepares their work station; Transfers hangers from hanger rack to shirt...

Construction Materials Testing (CMT) TechnicianThompson Engineering is seeking qualified Construction Materials Testing (CMT) Technicians for multiple locations. This position is responsible for the daily oversight of construction materials testing and inspection activities on active construction si...

The Tool Bender Operator is responsible for controlling setting bed angles and inspection of quality parts for conformance to requirements and tolerances of finished products sequence of operations and set up they ensure production rates are met or exceeded. Essential FunctionsReasonable accommodat...

Are you in search of a top-tier ophthalmology practice that is committed to delivering exceptional eye care services prioritizing the well-being and advancement of their patients vision health If your answer is yes then your quest concludes here. We are currently seeking a dedicated Ophthalmologist...

DescriptionThis position supports sales efforts at a Sherwin-Williams floorcovering store and coordinates installation through independent contractors to service wholesale floorcovering this role you will assist in schedule installation and ensure installation is conducted consistent with expectati...

DescriptionClean Harbors in Wichita KS is seeking a Class A CDL Equipment Operator to operate a variety of heavy and light duty trucks/work equipment at our customer sites; some of the vehicles operated include vacuum trucks Cuscos guzzlers and roll offs. This role is responsible for performing driv...

Are you in search of a top-tier ophthalmology practice that is committed to delivering exceptional eye care services prioritizing the well-being and advancement of their patients vision health If your answer is yes then your quest concludes here. We are currently seeking a dedicated Ophthalmologist...

Are you in search of a top-tier ophthalmology practice that is committed to delivering exceptional eye care services prioritizing the well-being and advancement of their patients vision health If your answer is yes then your quest concludes here. We are currently seeking a dedicated Ophthalmologist...

Temp To Full-TimeKey Responsibilities:Lawn Care: Mowing trimming aerating fertilizing overseeding and weed control to promote healthy turf growth.Landscaping: Designing installing and maintaining plants shrubs trees sod flower beds and hardscapes such as patios walkways and retaining walls. This may...

We are seeking an experienced Heavy Equipment Technician to support the inspection diagnosis repair and maintenance of construction and industrial equipment. This role may be based in a shop environment in the field or a combination of both depending on operational needs. The ideal candidate has str...

JoinaTeamthatBuildstoLastConcoConstruction!ConcoConstructionisseekinganEquipmentFieldMechanic -motivatedsafety-focusedandabletoworkindependentlyinafast-pacedenvironment.EquipmentFieldMechanicResponsibilitiesandQualifications:Diagnoseandrepairheavyandlightconstructionequipmentinthefieldincludingloade...

Build the Future with Us EquipmentShare is Hiring a Field Technician (Mechanic) (Pump Power & HVAC)At EquipmentShare were not just filling a role were assembling the best team on the planet to build something thats never been built before. Were on a mission to transform an industry thats been stuc...

Are you in search of a top-tier ophthalmology practice that is committed to delivering exceptional eye care services prioritizing the well-being and advancement of their patients vision health If your answer is yes then your quest concludes here. We are currently seeking a dedicated Ophthalmologist...

Are you in search of a top-tier ophthalmology practice that is committed to delivering exceptional eye care services prioritizing the well-being and advancement of their patients vision health If your answer is yes then your quest concludes here. We are currently seeking a dedicated Ophthalmologist...

Build the Future with Us EquipmentShare is Hiring an Outside Sales Retail Account Manager Heavy EquipmentAt EquipmentShare were not just filling a role were assembling the best team on the planet to build something thats never been built before. Were on a mission to transform an industry thats bee...

Build the Future with Us EquipmentShare is Hiring a Heavy Equipment District CDL DriverAt EquipmentShare were not just filling a role were assembling the best team on the planet to build something thats never been built before. Were on a mission to transform an industry thats been stuck in the pas...