Director of Engineering, Security
Director of Engineering, Security
Posted on :
30-07-2025
Employer Active
1 Vacancy
Job Alert
You will be updated with latest job alerts via emailValid email field required
Send jobs
Share
Send me jobs like this
Job Alert
You will be updated with latest job alerts via emailValid email field required
Send jobs
Monthly Salary
Not Disclosed
Salary Not Disclosed
Vacancy
1 Vacancy
Posted on :
30-07-2025
Job Description
Company Introduction
We exist to wow our customers. We know were doing the right thing when we hear our customers say How did we ever live without Coupang Born out of an obsession to make shopping eating and living easier than ever were collectively disrupting the multi-billion-dollar e-commerce industry from the ground up. We are one of the fastest-growing e-commerce companies that established an unparalleled reputation for being a dominant and reliable force in South Korean commerce.
We are proud to have the best of both worlds a startup culture with the resources of a large global public company. This fuels us to continue our growth and launch new services at the speed we have been since our inception. We are all entrepreneurs surrounded by opportunities to drive new initiatives and innovations. At our core we are bold and ambitious people that like to get our hands dirty and make a hands-on impact. At Coupang you will see yourself your colleagues your team and the company grow every day.
Our mission to build the future of commerce is real. We push the boundaries of whats possible to solve problems and break traditional tradeoffs. Join Coupang now to create an epic experience in this always-on high-tech and hyper-connected world.
Role Overview
We are looking for a hands-on Director of Engineering with deep technical expertise and a passion for building secure reliable and scalable systems. This role combines technical architecture leadership with people and delivery management. You will lead a team of talented senior engineers while staying close to the code and system design.
Your mission: drive the security quality and reliability of our core platforms while mentoring engineers scaling engineering excellence and partnering closely with product and leadership on roadmaps.
What You Will Do
- Buildandgrowahigh-performingteamofsenior/staff-levelengineersworkingindifferentgeographicareasfosteringautonomytrustandaccountability
- DesignandleadthearchitectureofsecurescalablebackendsystemsusingJava(SpringBoot)andAWScloud-nativeservices
- Drivecodequalitystandardsbestpracticestechnicalreviewsandsystemreliabilityacrossteamsownsystemreliabilityperformanceandsecurityposture
- LeadbyexamplewriteandreviewcodewhenneededunblockengineersandmakecriticalarchitecturaldecisionsCreateacultureoftechnicalexcellenceandcontinuouslearning
- Partnerwithproductandleadershiptodefineanddeliveronengineeringroadmapsandstrategicinitiatives
- IntegrateGenerativeAIcapabilities()intoproductworkflowsresponsiblyandsecurely
- Leaddesignandimplementationofauthenticationauthorizationandidentitymanagementsolutions(SSOOIDCRBAC/ABACSCIMetc.)
- 15yearsofbackend/softwareengineeringexperiencewithatleast35yearsinengineeringleadershipexperienceinAI/MLdevelopmenthighlydesired
- ExpertiseinJavaSpringBootandAWSarchitectureandservices(3LambdaRDSIAMKMS)
- Trackrecordofleadingandscalingseniortechnicalteamsespeciallyinfast-pacedenvironments
- Comfortablemanagingdeliveryandroadmapplanningwhilestayingclosetotechnicaldetails
- PriorexperienceinSaaSplatformteamsorcloud-nativeproductenvironmentsisamust
What Youll Get
- A leadership role with real technical impact youre not just managing youre helping shape the product
- Opportunity to scale a high-performance engineering culture from the ground up
- A team-first no-ego engineering culture where excellence is expected and supported
Education & Experience
- Bachelors degree in Computer Science Engineering or a related technical field (Masters/PhD preferred)
- 15 years of experience in software development/security engineering or 8 years if holding an advanced degree
- At least 6 years of people management experience (leading teams mentoring senior contributors globally)
Technical & Leadership Experience
- Strong hands-on experience in designing and developing large-scale distributed systems in recent years (last 34 years)
- Proven track record of delivering mission-critical scalable systems in production at scale
- Experience working with cloud platformsAWS Azure or GCPespecially for authentication/identity systems and ML infrastructure
- Domain knowledge in security architecture authentication/authorization cryptography secure SDLC practices
Soft Skills
- Strong stakeholder alignment and influence across cross-functional teams
- Ability to draw roadmaps prioritize under pressure andexecute in fast-paced or ambiguous environments
- Track record of building and growing high-performing security teams at scale
Pay & Benefits
Our compensation reflects the cost of labor across several US geographic markets. At Coupang your base pay is one part of your total compensation.
The base pay for this position ranges from $170100/year in our lowest geographic market to $315900/year in our highest geographic market. Pay is based on several factors including market location and may vary depending on job-related knowledge skills and experience.
General Description of All Benefits
- Medical/Dental/Vision/Life AD&D insurance
- Flexible Spending Accounts (FSA) & Health Savings Account (HSA)
- Long-term/Short-term Disability
- Employee Assistance Program (EAP) program
- 401K Plan with Company Match
- 18-21 days of the Paid Time Off (PTO) a year based on the tenure
- 12 Public Holidays
- Paid Parental leave
- Pre-tax commuterbenefits
- MTV - Free Electric Car Charging Station
General Description of Other Compensation
Other Compensation includes but is not limited to bonuses equityor other forms of compensation that would be offered to the hired applicant in addition to their established salary range or wage scale.
Coupang is an equal opportunity employer. All qualified applicants will receive consideration for employment without regard to actual or perceived race (including traits historically associated with race including but not limited to hair texture and protective hair styles) color religion religious creed (including religious dress and grooming practices) sex or gender (including pregnancy childbirth breastfeeding and medical conditions related to pregnancy childbirth or breastfeeding) gender identity gender expression sexual orientation ancestry national origin (including language use restrictions) age (40 and over) physical or mental disability medical condition genetic information HIV/AIDS or Hepatitis C status family status (including but not limited to marital or domestic partnership status) military or veteran status use of a trained dog guide or service animal political activities or affiliations ancestry citizenship family and medical leave status status as a victim of any violent crime or any other characteristic or class protected by the laws or regulations in the locations where we is also committed to providing a safe work environment for its employees and its you need assistance and/or a reasonable accommodation in the application of recruiting process due to a disability please contact us at
Required Experience:
Director
Employment Type
Full-Time
Key Skills
Report This Job
Disclaimer: Drjobpro.com is only a platform that connects job seekers and employers. Applicants are advised to conduct their own independent research into the credentials of the prospective employer.We always make certain that our clients do not endorse any request for money payments, thus we advise against sharing any personal or bank-related information with any third party. If you suspect fraud or malpractice, please contact us via contact us page.
